Project name: b047bdf71b84743

Status: done

submitted: 2019-03-01 11:13:28, status changed: 2019-03-01 11:16:58
Settings
Chain sequence(s) A: GIVEQCCTSICSLYQLENYCN
B: FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.17
Maximal score value
2.5183
Average score
-0.1945
Total score value
-9.9177

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.5543
2 I A -0.3216
3 V A -0.2533
4 E A -0.9853
5 Q A -0.9716
6 C A 0.0000
7 C A -0.4760
8 T A -0.4782
9 S A -0.5033
10 I A -0.1855
11 C A 0.0000
12 S A 0.6319
13 L A 1.2799
14 Y A 0.8137
15 Q A -0.2097
16 L A 0.0000
17 E A -1.1313
18 N A -1.3652
19 Y A 0.0000
20 C A 0.0000
21 N A -1.6669
1 F B 2.5183
2 V B 1.8884
3 N B -0.1937
4 Q B -0.8173
5 H B -1.1366
6 L B 0.0000
7 C B -0.4037
8 G B -0.5697
9 S B -1.0252
10 H B -1.6744
11 L B 0.0000
12 V B 0.0902
13 E B -1.1781
14 A B 0.1634
15 L B 0.0000
16 Y B 1.2948
17 L B 1.5954
18 V B 0.8050
19 C B 0.0000
20 G B -0.6242
21 E B -2.0594
22 R B -2.1700
23 G B -0.5490
24 F B 0.6167
25 F B 2.1660
26 Y B 1.2629
27 T B 0.0844
28 P B -0.8332
29 K B -1.8342
30 T B -0.9578

 

Laboratory of Theory of Biopolymers 2015