Project name: SH3_4JZ4_N135T [mutate: NA135T]

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	NA135T
Energy difference between WT (input) and mutated protein (by FoldX)	0.501781 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4701
• Maximal score value: 1.2498
• Average score: -0.8334
• Total score value: -50.0064

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.0983
87	V	A	-0.6074
88	A	A	0.0000
89	L	A	-0.0890
90	Y	A	-0.5324
91	D	A	-2.8182
92	Y	A	-2.0873
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3261
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4701
104	K	A	-2.8312
105	G	A	-1.9519
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4377
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8135
114	T	A	-1.7328
115	E	A	-2.9357
116	G	A	-2.4777
117	D	A	-2.4733
118	W	A	-1.1778
119	W	A	-0.5779
120	L	A	0.4020
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4950
130	G	A	0.0000
131	Y	A	0.2148
132	I	A	0.0000
133	P	A	-0.1674
134	S	A	-0.6881
135	T	A	-0.0200	mutated: NA135T
136	Y	A	0.4383
137	V	A	0.0000
138	A	A	0.2143
139	P	A	-0.1505
140	S	A	-0.1759