Project name: SH3_D117W

Status: done

submitted: 2019-03-14 15:30:28, status changed: 2019-03-14 17:40:04
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues DA117W
Energy difference between WT (input) and mutated protein (by FoldX) 0.312621 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4838
Maximal score value
1.252
Average score
-0.7195
Total score value
-43.1692

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1044
87 V A -0.6223
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1053
93 E A -2.8812
94 S A 0.0000
95 R A -2.7834
96 T A -2.1532
97 E A -2.3518
98 T A -1.2397
99 D A -1.3096
100 L A 0.0000
101 S A -1.9027
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -2.0714
108 L A 0.0000
109 Q A -0.2485
110 I A 0.4387
111 V A 1.2520
112 N A -0.3968
113 N A -1.3469
114 T A -1.3408
115 E A -2.0110
116 G A -1.1064
117 W A 0.3469 mutated: DA117W
118 W A 0.2039
119 W A 0.0380
120 L A 0.4334
121 A A 0.0000
122 H A -0.3830
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8780
127 G A -0.8169
128 Q A -1.4117
129 T A -0.4938
130 G A 0.0000
131 Y A 0.5617
132 I A 0.0000
133 P A 0.0000
134 S A -0.3146
135 N A -0.7003
136 Y A -0.1951
137 V A 0.0000
138 A A -0.0212
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015