Project name: b190f4145a4e79a

Status: done

submitted: 2021-09-09 07:04:05, status changed: 2021-09-09 09:34:50
Settings
Chain sequence(s) A: LYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Distance of aggregation 10 Å
Dynamic mode Yes
Show buried residues

Minimal score value
-4.32
Maximal score value
1.9015
Average score
-0.8663
Total score value
-238.221

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
44 L A 0.8124
45 Y A -0.0636
46 E A -1.7181
47 D A 0.0000
48 P A -1.5144
49 P A -1.7642
50 D A -2.9396
51 Q A -2.8833
52 K A -3.0841
53 T A -1.9341
54 S A -1.1483
55 P A -0.8131
56 S A -0.9953
57 G A -1.4855
58 K A -2.3599
59 P A -1.4745
60 A A -0.5767
61 T A -0.3041
62 L A 0.0000
63 K A -0.3111
64 I A 0.0000
65 C A 0.0000
66 S A 0.0000
67 W A 0.0000
68 N A 0.0000
69 V A 0.0000
70 D A -0.7254
71 G A 0.0000
72 L A 0.0000
73 R A -2.9273
74 A A -2.1205
75 W A 0.0000
76 I A -2.0172
77 K A -3.2303
78 K A -3.3139
79 K A -3.2039
80 G A 0.0000
81 L A 0.0000
82 D A -3.6233
83 W A -2.4629
84 V A 0.0000
85 K A -3.4692
86 E A -3.3034
87 E A -2.1813
88 A A -1.8222
89 P A 0.0000
90 D A -1.1792
91 I A 0.0000
92 L A 0.0000
93 C A 0.0000
94 L A 0.0000
95 Q A 0.0000
96 E A 0.0000
97 T A -0.9992
98 K A -2.3209
99 C A 0.0000
100 S A -3.1293
101 E A -3.6865
102 N A -3.5057
103 K A -3.1041
104 L A 0.0000
105 P A -2.2836
106 A A -2.0012
107 E A -2.0502
108 L A 0.0000
109 Q A -2.2368
110 E A -2.4745
111 L A -1.2624
112 P A -1.2528
113 G A -1.5814
114 L A 0.0000
115 S A -1.6360
116 H A -1.5129
117 Q A -1.2237
118 Y A -0.0216
119 W A -0.1260
120 S A 0.0433
121 A A -1.3812
122 P A -2.0100
123 S A -2.4243
124 D A -3.5451
125 K A -3.8856
126 E A -4.0658
127 G A -3.1602
128 Y A 0.0000
129 S A -1.2361
130 G A 0.0000
131 V A 0.0000
132 G A 0.0000
133 L A 0.0000
134 L A 0.0000
135 S A 0.0000
136 R A -1.8933
137 Q A -1.8196
138 C A -1.3409
139 P A -1.0748
140 L A -1.1221
141 K A -1.0224
142 V A 1.0484
143 S A 0.9810
144 Y A 1.3429
145 G A -0.4436
146 I A -0.9639
147 G A -2.4021
148 D A -3.7801
149 E A -4.3200
150 E A -4.0521
151 H A 0.0000
152 D A -3.3449
153 Q A -3.5863
154 E A -2.7364
155 G A 0.0000
156 R A -0.5336
157 V A 0.0000
158 I A 0.0000
159 V A 0.0000
160 A A 0.0000
161 E A -1.0606
162 F A 0.0000
163 D A -2.2400
164 S A -1.1314
165 F A 0.0000
166 V A 0.0000
167 L A 0.0000
168 V A 0.0000
169 T A 0.0000
170 A A 0.0000
171 Y A 0.2234
172 V A 0.0000
173 P A -0.4805
174 N A -1.3682
175 A A 0.0000
176 G A -1.5486
177 R A -1.7888
178 G A -0.0214
179 L A 1.5441
180 V A 1.9015
181 R A 0.3863
182 L A 0.0000
183 E A -0.0194
184 Y A 0.2315
185 R A 0.0000
186 Q A 0.0000
187 R A -1.3193
188 W A 0.0000
189 D A 0.0000
190 E A -1.3554
191 A A -1.3038
192 F A 0.0000
193 R A 0.0000
194 K A -2.2192
195 F A -0.8741
196 L A 0.0000
197 K A -2.3667
198 G A -1.5618
199 L A 0.0000
200 A A -1.4391
201 S A -1.3192
202 R A -1.6988
203 K A -1.4961
204 P A -0.7067
205 L A 0.0000
206 V A 0.0000
207 L A 0.0000
208 C A 0.0000
209 G A 0.0000
210 D A 0.0000
211 L A 0.0000
212 N A 0.0000
213 V A 0.0000
214 A A 0.0000
215 H A -1.9314
216 E A -3.0316
217 E A -2.9265
218 I A -1.4466
219 D A -1.8679
220 L A -0.4444
221 R A -1.7580
222 N A -2.6271
223 P A -2.8285
224 K A -3.0499
225 G A -2.6146
226 N A -2.9014
227 K A -3.6119
228 K A -2.9415
229 N A -1.9163
230 A A -1.8160
231 G A 0.0000
232 F A 0.0000
233 T A -1.5088
234 P A -1.2899
235 Q A -1.2868
236 E A 0.0000
237 R A -1.8545
238 Q A -2.0493
239 G A 0.0000
240 F A 0.0000
241 G A -1.4721
242 E A -1.9351
243 L A 0.0000
244 L A -0.5278
245 Q A -1.4427
246 A A -1.4664
247 V A 0.0000
248 P A -0.8903
249 L A -0.0027
250 A A -0.0170
251 D A -0.2273
252 S A 0.0000
253 F A 0.0000
254 R A -0.7737
255 H A -1.0173
256 L A -0.1972
257 Y A -0.5451
258 P A -1.0212
259 N A -1.3811
260 T A -0.7823
261 P A 0.0165
262 Y A 0.8882
263 A A 0.0000
264 Y A 0.4564
265 T A 0.0000
266 F A 0.0000
267 W A 0.9783
268 T A 0.6009
269 Y A 1.3079
270 M A 0.0000
271 M A 0.2937
272 N A -0.9413
273 A A 0.0000
274 R A -1.1801
275 S A -1.8061
276 K A -2.6455
277 N A -2.2098
278 V A -1.0541
279 G A -0.7299
280 W A 0.0000
281 R A 0.0000
282 L A 0.0000
283 D A 0.0000
284 Y A 0.0000
285 F A 0.0000
286 L A 0.0000
287 L A 0.0000
288 S A 0.0000
289 H A -0.5332
290 S A 0.0297
291 L A 0.0000
292 L A 1.1938
293 P A 0.3066
294 A A 0.0000
295 L A 0.5014
296 C A 0.0000
297 D A 0.0000
298 S A 0.0000
299 K A -1.0468
300 I A 0.0000
301 R A -1.1958
302 S A 0.0000
303 K A -0.6498
304 A A -0.5132
305 L A 0.0000
306 G A 0.0000
307 S A 0.1703
308 D A 0.4625
309 H A 0.0000
310 C A 0.0000
311 P A 0.0000
312 I A 0.0000
313 T A 0.0000
314 L A 0.0000
315 Y A -0.2380
316 L A 0.0000
317 A A 0.1451
318 L A 0.8809

Above is the comparison between the input structure and the most aggregation prone model (predicted in the flexibility simulations, download both models in the PDB file format , download table with rmsd values ). The picture presents the most aggregation prone model (in blue) superimposed on the input structure (in red). The plot shows rmsd profile (distances between residues of the superimposed structures).

Dynamic mode uses CABS-flex simulations of protein structure fluctuations. The structure fluctuations may have impact on the size and extent of aggregation "hot-spots" on the protein surface. The dynamic mode uses the following pipeline: (1) based on the input structure, CABS-flex predicts a set of different models reflecting protein dynamics in solution; (2) for each of these models A3D score is calculated; (3) finally, the most aggregation prone model (the model with the highest A3D score, -0.8663 in this case) is selected and presented in A3D results.


 

Laboratory of Theory of Biopolymers 2015