Project name: b2cfa74a82d8807

Chain sequence(s)	A: ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARS
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -2.8804
• Maximal score value: 1.4586
• Average score: -0.9044
• Total score value: -59.6897

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-1.0996
2	L	A	1.0449
3	Y	A	1.4586
4	H	A	0.6813
5	Y	A	0.0734
6	Q	A	-1.5554
7	E	A	-2.7358
8	C	A	-1.5239
9	V	A	-0.5431
10	R	A	-2.1875
11	G	A	-1.0850
12	T	A	-0.2396
13	T	A	0.1253
14	V	A	0.6274
15	L	A	0.3805
16	L	A	-0.5697
17	K	A	-2.3596
18	E	A	-1.8536
19	P	A	-0.7816
20	C	A	-0.9069
21	S	A	-0.9283
22	S	A	-0.5811
23	G	A	-0.6896
24	T	A	-0.5625
25	Y	A	-0.5514
26	E	A	-2.0476
27	G	A	-1.7810
28	N	A	-1.9002
29	S	A	-1.0906
30	P	A	-0.7321
31	F	A	-0.3136
32	H	A	-0.6726
33	P	A	-0.9553
34	L	A	-0.5440
35	A	A	-1.0958
36	D	A	-2.7043
37	N	A	-2.8420
38	K	A	-2.3110
39	F	A	0.0000
40	A	A	0.0000
41	L	A	0.1895
42	T	A	-0.1142
43	C	A	0.0000
44	F	A	-1.0275
45	S	A	-1.6299
46	T	A	-1.1507
47	Q	A	-1.5693
48	F	A	0.0000
49	A	A	0.0000
50	F	A	0.0000
51	A	A	-1.1521
52	C	A	0.0000
53	P	A	-1.4174
54	D	A	-2.1547
55	G	A	-1.7441
56	V	A	-1.1468
57	K	A	-1.3113
58	H	A	0.0000
59	V	A	0.0000
60	Y	A	0.0000
61	Q	A	-0.9810
62	L	A	0.0000
63	R	A	-2.8804
64	A	A	-2.4198
65	R	A	-2.6297
66	S	A	-1.1974