Project name: SH3_Q128H

Status: done

submitted: 2019-03-14 15:36:53, status changed: 2019-03-14 18:16:48
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues QA128H
Energy difference between WT (input) and mutated protein (by FoldX) 0.492775 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4831
Maximal score value
1.2498
Average score
-0.8856
Total score value
-53.135

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1044
87 V A -0.6223
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8525
92 Y A -2.1050
93 E A -2.8807
94 S A 0.0000
95 R A -2.7834
96 T A -2.1538
97 E A -2.3526
98 T A -1.2412
99 D A -1.3011
100 L A 0.0000
101 S A -1.8679
102 F A 0.0000
103 K A -3.4831
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -2.0710
108 L A 0.0000
109 Q A -0.2491
110 I A 0.4372
111 V A 1.2498
112 N A -0.4200
113 N A -1.8142
114 T A -1.7328
115 E A -2.9363
116 G A -2.6085
117 D A -2.6844
118 W A -1.3424
119 W A -0.6978
120 L A 0.4047
121 A A 0.0000
122 H A -0.3328
123 S A 0.0000
124 L A -0.2516
125 T A -0.7545
126 T A -0.8225
127 G A -0.7463
128 H A -1.2183 mutated: QA128H
129 T A -0.3995
130 G A 0.0000
131 Y A 0.2199
132 I A 0.0000
133 P A 0.0000
134 S A -1.2857
135 N A -1.2485
136 Y A -0.2039
137 V A 0.0000
138 A A -0.0212
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015