Project name: SH3_Y92W

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA92W
Energy difference between WT (input) and mutated protein (by FoldX)	2.41193 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4672
• Maximal score value: 1.2496
• Average score: -0.9007
• Total score value: -54.0391

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1123
87	V	A	-0.6331
88	A	A	0.0000
89	L	A	-0.3289
90	Y	A	-0.7407
91	D	A	-2.8322
92	W	A	-2.0546	mutated: YA92W
93	E	A	-2.8539
94	S	A	0.0000
95	R	A	-2.7829
96	T	A	-2.1624
97	E	A	-2.3602
98	T	A	-1.2536
99	D	A	-1.3480
100	L	A	0.0000
101	S	A	-1.8883
102	F	A	0.0000
103	K	A	-3.4672
104	K	A	-2.8610
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2494
110	I	A	0.4376
111	V	A	1.2496
112	N	A	-0.4282
113	N	A	-1.8246
114	T	A	-1.7407
115	E	A	-2.9507
116	G	A	-2.6230
117	D	A	-2.7079
118	W	A	-1.4018
119	W	A	-0.7234
120	L	A	0.3921
121	A	A	0.0000
122	H	A	-0.3828
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4150
129	T	A	-0.4983
130	G	A	0.0000
131	Y	A	0.2028
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3241
135	N	A	-1.2909
136	Y	A	-0.2721
137	V	A	0.0000
138	A	A	-0.0363
139	P	A	-0.1505
140	S	A	-0.1759