Project name: SH3_L120N

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA120N
Energy difference between WT (input) and mutated protein (by FoldX)	1.87405 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4774
• Maximal score value: 1.14
• Average score: -0.9271
• Total score value: -55.6271

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1047
87	V	A	-0.6192
88	A	A	0.0000
89	L	A	-0.2999
90	Y	A	-0.7095
91	D	A	-2.8409
92	Y	A	-2.1027
93	E	A	-2.8834
94	S	A	0.0000
95	R	A	-2.7841
96	T	A	-2.1602
97	E	A	-2.3589
98	T	A	-1.3184
99	D	A	-1.4243
100	L	A	0.0000
101	S	A	-1.9127
102	F	A	0.0000
103	K	A	-3.4774
104	K	A	-2.8504
105	G	A	-1.9568
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.3032
110	I	A	0.3332
111	V	A	1.1400
112	N	A	-0.4898
113	N	A	-1.8779
114	T	A	-1.7591
115	E	A	-2.9748
116	G	A	-2.5963
117	D	A	-2.6904
118	W	A	-1.4517
119	W	A	-0.9194
120	N	A	-0.0635	mutated: LA120N
121	A	A	0.0000
122	H	A	-0.4843
123	S	A	0.0000
124	L	A	-0.2799
125	T	A	-0.7803
126	T	A	-0.8783
127	G	A	-0.8173
128	Q	A	-1.4128
129	T	A	-0.6042
130	G	A	0.0000
131	Y	A	-0.0368
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3526
135	N	A	-1.2468
136	Y	A	-0.1997
137	V	A	0.0000
138	A	A	-0.0219
139	P	A	-0.1505
140	S	A	-0.1759