Project name: SH3_T96Y

Status: done

submitted: 2019-03-14 15:17:37, status changed: 2019-03-14 16:21:19
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues TA96Y
Energy difference between WT (input) and mutated protein (by FoldX) -0.50315 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.495
Maximal score value
1.252
Average score
-0.8241
Total score value
-49.4466

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1044
87 V A -0.6223
88 A A 0.0000
89 L A -0.3176
90 Y A -0.7477
91 D A -2.8744
92 Y A -2.1399
93 E A -2.7206
94 S A 0.0000
95 R A -2.0960
96 Y A -0.7401 mutated: TA96Y
97 E A -1.6544
98 T A -0.7691
99 D A -0.8127
100 L A 0.0000
101 S A -1.7381
102 F A 0.0000
103 K A -3.4950
104 K A -2.8688
105 G A -1.9621
106 E A 0.0000
107 R A -2.0714
108 L A 0.0000
109 Q A -0.2485
110 I A 0.4387
111 V A 1.2520
112 N A -0.4167
113 N A -1.8130
114 T A -1.7323
115 E A -2.9367
116 G A -2.6094
117 D A -2.6862
118 W A -1.3344
119 W A -0.6871
120 L A 0.4216
121 A A 0.0000
122 H A -0.3830
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8780
127 G A -0.8169
128 Q A -1.4027
129 T A -0.4783
130 G A 0.0000
131 Y A 0.4110
132 I A 0.0000
133 P A 0.0000
134 S A -1.2864
135 N A -1.2490
136 Y A -0.2112
137 V A 0.0000
138 A A -0.0212
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015