Project name: test1

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	5 Å
Dynamic mode	No

• Minimal score value: -2.2833
• Maximal score value: 1.739
• Average score: -0.4076
• Total score value: -24.4549

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.5058
82	S	A	-0.4802
83	H	A	-0.8342
84	M	A	0.8703
85	T	A	0.0000
86	F	A	0.2403
87	V	A	0.3728
88	A	A	0.0000
89	L	A	0.6166
90	Y	A	0.6176
91	D	A	-1.9685
92	Y	A	-0.4177
93	E	A	-1.7891
94	S	A	-0.6998
95	R	A	-1.8609
96	T	A	-0.7412
97	E	A	-1.8457
98	T	A	-0.4633
99	D	A	-0.2775
100	L	A	0.0000
101	S	A	-0.3157
102	F	A	0.0000
103	K	A	-2.2833
104	K	A	-2.1376
105	G	A	-0.7807
106	E	A	0.0000
107	R	A	-1.7914
108	L	A	0.0000
109	Q	A	-0.6143
110	I	A	0.5478
111	V	A	1.7390
112	N	A	-0.4048
113	N	A	-1.3635
114	T	A	-0.6382
115	E	A	-1.9184
116	G	A	-1.1316
117	D	A	-1.8007
118	W	A	0.1159
119	W	A	0.1696
120	L	A	0.3506
121	A	A	0.0000
122	H	A	-0.2395
123	S	A	0.0000
124	L	A	0.9182
125	T	A	0.1086
126	T	A	-0.1227
127	G	A	-0.6463
128	Q	A	-1.2881
129	T	A	-0.3225
130	G	A	0.0000
131	Y	A	0.4978
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-0.2688
135	N	A	-1.2225
136	Y	A	0.0844
137	V	A	0.0000
138	A	A	-0.0307
139	P	A	-0.2602
140	S	A	-0.2390