Project name: SH3_G127K

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	GA127K
Energy difference between WT (input) and mutated protein (by FoldX)	2.73781 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4827
• Maximal score value: 1.2575
• Average score: -0.9806
• Total score value: -58.8342

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8530
92	Y	A	-2.1060
93	E	A	-2.8820
94	S	A	0.0000
95	R	A	-2.7839
96	T	A	-2.1542
97	E	A	-2.3526
98	T	A	-1.2415
99	D	A	-1.3232
100	L	A	0.0000
101	S	A	-1.9036
102	F	A	0.0000
103	K	A	-3.4827
104	K	A	-2.8616
105	G	A	-1.9619
106	E	A	0.0000
107	R	A	-2.2007
108	L	A	0.0000
109	Q	A	-0.3316
110	I	A	0.4454
111	V	A	1.2575
112	N	A	-0.4164
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.6943
120	L	A	0.4117
121	A	A	0.0000
122	H	A	-0.7550
123	S	A	0.0000
124	L	A	-1.1353
125	T	A	-1.3342
126	T	A	-1.6139
127	K	A	-2.2186	mutated: GA127K
128	Q	A	-2.0990
129	T	A	-0.8296
130	G	A	0.0000
131	Y	A	0.2242
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2857
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1505
140	S	A	-0.1759