Project name: SH3_W118F

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	WA118F
Energy difference between WT (input) and mutated protein (by FoldX)	-0.175774 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4733
• Maximal score value: 1.2477
• Average score: -0.8664
• Total score value: -51.9852

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3077
90	Y	A	-0.7264
91	D	A	-2.8324
92	Y	A	-2.0579
93	E	A	-2.8534
94	S	A	0.0000
95	R	A	-2.7694
96	T	A	-2.1398
97	E	A	-2.3396
98	T	A	-1.2206
99	D	A	-1.2314
100	L	A	0.0000
101	S	A	-1.8800
102	F	A	0.0000
103	K	A	-3.4733
104	K	A	-2.8548
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4351
111	V	A	1.2477
112	N	A	-0.3762
113	N	A	-1.7462
114	T	A	-1.6842
115	E	A	-2.8405
116	G	A	-2.5108
117	D	A	-2.5169
118	F	A	-0.9925	mutated: WA118F
119	W	A	-0.5273
120	L	A	0.4830
121	A	A	0.0000
122	H	A	-0.3866
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4064
129	T	A	-0.4893
130	G	A	0.0000
131	Y	A	0.3205
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.1769
135	N	A	-1.1999
136	Y	A	-0.1614
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1505
140	S	A	-0.1759