Project name: SH3_Q128P

Status: done

submitted: 2019-03-14 15:37:06, status changed: 2019-03-14 18:18:59
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues QA128P
Energy difference between WT (input) and mutated protein (by FoldX) 3.65205 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4878
Maximal score value
1.2495
Average score
-0.8422
Total score value
-50.5324

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1044
87 V A -0.6223
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8535
92 Y A -2.1069
93 E A -2.8832
94 S A 0.0000
95 R A -2.7843
96 T A -2.1545
97 E A -2.3526
98 T A -1.2419
99 D A -1.2154
100 L A 0.0000
101 S A -1.7415
102 F A 0.0000
103 K A -3.4878
104 K A -2.8616
105 G A -1.9615
106 E A 0.0000
107 R A -2.0732
108 L A 0.0000
109 Q A -0.2486
110 I A 0.4368
111 V A 1.2495
112 N A -0.4201
113 N A -1.8142
114 T A -1.7328
115 E A -2.9363
116 G A -2.6085
117 D A -2.6844
118 W A -1.3424
119 W A -0.6979
120 L A 0.4043
121 A A 0.0000
122 H A -0.0993
123 S A 0.0000
124 L A -0.1005
125 T A -0.6294
126 T A -0.5780
127 G A -0.3453
128 P A -0.3787 mutated: QA128P
129 T A 0.0121
130 G A 0.0000
131 Y A 0.2188
132 I A 0.0000
133 P A 0.0000
134 S A -1.2857
135 N A -1.2485
136 Y A -0.2039
137 V A 0.0000
138 A A -0.0212
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015