Project name: SH3_T129V

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	TA129V
Energy difference between WT (input) and mutated protein (by FoldX)	0.413667 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.4417
• Average score: -0.7961
• Total score value: -47.7649

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4540
82	S	A	-0.6866
83	H	A	-0.7941
84	M	A	0.2617
85	T	A	0.0000
86	F	A	-0.1109
87	V	A	-0.6257
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-0.9527
99	D	A	-0.9991
100	L	A	0.0000
101	S	A	-1.6380
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.1037
108	L	A	0.0000
109	Q	A	-0.1083
110	I	A	0.5856
111	V	A	1.4417
112	N	A	-0.4381
113	N	A	-1.8156
114	T	A	-1.7335
115	E	A	-2.9370
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3438
119	W	A	-0.7131
120	L	A	0.7321
121	A	A	0.0000
122	H	A	0.2580
123	S	A	0.0000
124	L	A	-0.1186
125	T	A	-0.8152
126	T	A	-0.6519
127	G	A	-0.4386
128	Q	A	-0.5514
129	V	A	1.2862	mutated: TA129V
130	G	A	0.0000
131	Y	A	0.5685
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2864
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1532
140	S	A	-0.1759