Project name: SH3_S134M

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA134M
Energy difference between WT (input) and mutated protein (by FoldX)	-0.246427 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4735
• Maximal score value: 1.2438
• Average score: -0.879
• Total score value: -52.7378

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4503
82	S	A	-0.6820
83	H	A	-0.7912
84	M	A	0.2690
85	T	A	0.0000
86	F	A	-0.0876
87	V	A	-0.6016
88	A	A	0.0000
89	L	A	-0.2641
90	Y	A	-0.6724
91	D	A	-2.8196
92	Y	A	-2.0859
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3315
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4735
104	K	A	-2.8326
105	G	A	-1.9539
106	E	A	0.0000
107	R	A	-2.0690
108	L	A	0.0000
109	Q	A	-0.2448
110	I	A	0.4682
111	V	A	1.2438
112	N	A	-0.4320
113	N	A	-1.7859
114	T	A	-1.7413
115	E	A	-2.9095
116	G	A	-2.5547
117	D	A	-2.6018
118	W	A	-1.2644
119	W	A	-0.6606
120	L	A	0.4190
121	A	A	0.0000
122	H	A	-0.3873
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4944
130	G	A	0.0000
131	Y	A	0.2412
132	I	A	0.0000
133	P	A	-0.3942
134	M	A	-0.9644	mutated: SA134M
135	N	A	-1.0602
136	Y	A	-0.0123
137	V	A	0.0000
138	A	A	0.0479
139	P	A	-0.1471
140	S	A	-0.1735