Project name: SH3_W119T

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	WA119T
Energy difference between WT (input) and mutated protein (by FoldX)	3.29542 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2377
• Average score: -0.8776
• Total score value: -52.6575

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4451
82	S	A	-0.6773
83	H	A	-0.7912
84	M	A	0.2952
85	T	A	0.0000
86	F	A	0.0521
87	V	A	-0.5158
88	A	A	0.0000
89	L	A	-0.2407
90	Y	A	-0.7051
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3433
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8372
105	G	A	-1.9284
106	E	A	0.0000
107	R	A	-2.0181
108	L	A	0.0000
109	Q	A	-0.2010
110	I	A	0.4781
111	V	A	1.2377
112	N	A	-0.4618
113	N	A	-1.8765
114	T	A	-1.7674
115	E	A	-2.9837
116	G	A	-2.6527
117	D	A	-2.7365
118	W	A	-1.4416
119	T	A	0.0000	mutated: WA119T
120	L	A	0.3251
121	A	A	0.0000
122	H	A	-0.3911
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4900
130	G	A	0.0000
131	Y	A	0.1600
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3127
135	N	A	-1.2269
136	Y	A	-0.1160
137	V	A	-0.0345
138	A	A	0.0943
139	P	A	-0.0624
140	S	A	-0.1176