Project name: SH3_I110C

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	IA110C
Energy difference between WT (input) and mutated protein (by FoldX)	2.57671 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.1863
• Average score: -0.9101
• Total score value: -54.6037

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4714
82	S	A	-0.7010
83	H	A	-0.7912
84	M	A	0.2424
85	T	A	0.0000
86	F	A	-0.1374
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1625
97	E	A	-2.3611
98	T	A	-1.2576
99	D	A	-1.3543
100	L	A	0.0000
101	S	A	-1.9140
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0883
108	L	A	0.0000
109	Q	A	-0.3224
110	C	A	0.2792	mutated: IA110C
111	V	A	1.1863
112	N	A	-0.4361
113	N	A	-1.8417
114	T	A	-1.7228
115	E	A	-2.9344
116	G	A	-2.6130
117	D	A	-2.7063
118	W	A	-1.3807
119	W	A	-0.7504
120	L	A	0.3624
121	A	A	0.0000
122	H	A	-0.4264
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.5218
130	G	A	0.0000
131	Y	A	0.1331
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3191
135	N	A	-1.2524
136	Y	A	-0.2068
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1677
140	S	A	-0.1759