Project name: 12_w [mutate: PA112H]

Chain sequence(s)	A: KTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQ
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	PA112H
Energy difference between WT (input) and mutated protein (by FoldX)	3.38696 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.5408
• Maximal score value: 0.6676
• Average score: -1.1164
• Total score value: -187.5513

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
102	K	A	-2.6302
103	T	A	-1.7425
104	S	A	0.0000
105	D	A	0.0000
106	L	A	0.0000
107	I	A	0.0000
108	V	A	0.0000
109	L	A	0.0000
110	G	A	0.0000
111	L	A	0.0000
112	H	A	-1.3291	mutated: PA112H
113	W	A	-0.9590
114	K	A	-2.0609
115	T	A	-1.8167
116	T	A	-1.5372
117	E	A	-1.8710
118	Q	A	-2.4496
119	D	A	-2.5519
120	L	A	0.0000
121	K	A	-2.3394
122	E	A	-2.7208
123	Y	A	-1.3207
124	F	A	0.0000
125	S	A	-1.1473
126	T	A	-0.5939
127	F	A	-0.4419
128	G	A	-1.2628
129	E	A	-1.8192
130	V	A	0.0000
131	L	A	0.6676
132	M	A	0.0000
133	V	A	0.0000
134	Q	A	-0.7140
135	V	A	-0.5636
136	K	A	-0.8423
137	K	A	-1.5544
138	D	A	-1.1433
139	L	A	-0.2015
140	K	A	-1.4236
141	T	A	-1.2063
142	G	A	-1.1689
143	H	A	-1.7449
144	S	A	-1.2576
145	K	A	-1.1282
146	G	A	0.0000
147	F	A	0.0000
148	G	A	0.0000
149	F	A	0.0000
150	V	A	0.0000
151	R	A	-0.2701
152	F	A	0.0000
153	T	A	-1.2041
154	E	A	-2.4693
155	Y	A	-1.7751
156	E	A	-2.1778
157	T	A	0.0000
158	Q	A	0.0000
159	V	A	-0.7316
160	K	A	-1.0239
161	V	A	0.0000
162	M	A	-0.8454
163	S	A	-1.2094
164	Q	A	-2.2138
165	R	A	-2.1175
166	H	A	0.0000
167	M	A	-0.0036
168	I	A	0.0000
169	D	A	-2.2862
170	G	A	-1.2245
171	R	A	-0.6333
172	W	A	0.2746
173	C	A	0.0000
174	D	A	-0.9090
175	C	A	0.0000
176	K	A	-1.2554
177	L	A	-0.5666
178	P	A	0.0000
179	N	A	-1.5628
180	S	A	-1.0955
181	K	A	0.0000
182	Q	A	-2.0195
183	S	A	-1.8968
184	Q	A	-2.9065
185	D	A	-3.5131
186	E	A	-2.8342
187	P	A	-1.3945
188	L	A	-0.3245
189	R	A	-2.4814
190	S	A	-3.0756
191	R	A	-2.8269
192	K	A	-2.1450
193	V	A	0.0000
194	F	A	-0.2102
195	V	A	0.0000
196	G	A	0.0000
197	R	A	-0.4165
198	C	A	0.0000
199	T	A	-1.4065
200	E	A	-2.5271
201	D	A	-3.0291
202	M	A	0.0000
203	T	A	-1.9051
204	E	A	-2.0250
205	D	A	-3.2482
206	E	A	-3.0355
207	L	A	0.0000
208	R	A	-3.0567
209	E	A	-3.2680
210	F	A	-1.8761
211	F	A	0.0000
212	S	A	-1.6230
213	Q	A	-1.6852
214	Y	A	-0.4521
215	G	A	-1.2935
216	D	A	-1.9551
217	V	A	0.0000
218	M	A	-0.7398
219	D	A	-1.8460
220	V	A	-1.1802
221	F	A	-0.0404
222	I	A	0.0000
223	P	A	0.0000
224	K	A	-1.7006
225	P	A	-1.3880
226	F	A	-0.9152
227	R	A	-0.8767
228	A	A	0.0000
229	F	A	0.0000
230	A	A	0.0000
231	F	A	0.0000
232	V	A	0.0000
233	T	A	-1.2223
234	F	A	0.0000
235	A	A	-1.5708
236	D	A	-2.4934
237	D	A	-3.5408
238	Q	A	-2.9000
239	I	A	-1.9046
240	A	A	0.0000
241	Q	A	-2.2893
242	S	A	-1.4226
243	L	A	0.0000
244	C	A	0.0000
245	G	A	-1.9061
246	E	A	-2.1088
247	D	A	0.0000
248	L	A	0.0000
249	I	A	-0.1854
250	I	A	0.0000
251	K	A	-2.0210
252	G	A	-0.9185
253	I	A	0.0000
254	S	A	0.0000
255	V	A	0.0000
256	H	A	-0.5119
257	I	A	0.0000
258	S	A	-0.7096
259	N	A	-1.3033
260	A	A	0.0000
261	E	A	-2.7453
262	P	A	-2.5714
263	K	A	-2.5481
264	H	A	-2.3810
265	N	A	-2.9444
266	S	A	-2.7235
267	N	A	-3.2969
268	R	A	-3.3619
269	Q	A	-2.6772