Project name: SH3_L89K

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA89K
Energy difference between WT (input) and mutated protein (by FoldX)	-0.0746413 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.6705
• Maximal score value: 1.2498
• Average score: -0.9558
• Total score value: -57.3494

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1626
87	V	A	-0.7804
88	A	A	0.0000
89	K	A	-1.2989	mutated: LA89K
90	Y	A	-1.3714
91	D	A	-3.1399
92	Y	A	-2.2598
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3229
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.6705
104	K	A	-3.2559
105	G	A	-2.1993
106	E	A	0.0000
107	R	A	-2.0338
108	L	A	0.0000
109	Q	A	-0.2354
110	I	A	0.4372
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9362
116	G	A	-2.6084
117	D	A	-2.6843
118	W	A	-1.3422
119	W	A	-0.6977
120	L	A	0.4047
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4950
130	G	A	0.0000
131	Y	A	0.2197
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2842
135	N	A	-1.4056
136	Y	A	-0.5411
137	V	A	0.0000
138	A	A	-0.1781
139	P	A	-0.1208
140	S	A	-0.1441