Project name: SH3_T126L

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	TA126L
Energy difference between WT (input) and mutated protein (by FoldX)	-0.981273 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.1908
• Maximal score value: 1.2498
• Average score: -0.8339
• Total score value: -50.0325

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.6017
88	A	A	0.0000
89	L	A	-0.2818
90	Y	A	-0.6881
91	D	A	-2.7658
92	Y	A	-2.0518
93	E	A	-2.8458
94	S	A	0.0000
95	R	A	-2.7813
96	T	A	-2.1522
97	E	A	-2.3526
98	T	A	-1.2396
99	D	A	-1.3190
100	L	A	0.0000
101	S	A	-1.7520
102	F	A	0.0000
103	K	A	-3.1908
104	K	A	-2.7674
105	G	A	-1.9112
106	E	A	0.0000
107	R	A	-1.9277
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4372
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.6978
120	L	A	0.4047
121	A	A	0.0000
122	H	A	-0.2531
123	S	A	0.0000
124	L	A	-0.0035
125	T	A	-0.3164
126	L	A	0.0422	mutated: TA126L
127	G	A	-0.3729
128	Q	A	-1.1138
129	T	A	-0.3662
130	G	A	0.0000
131	Y	A	0.2219
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2857
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1505
140	S	A	-0.1759