Project name: kanti [mutate: WA145A, WA142A, WA159A, FA59A, YA108A]

Status: done

submitted: 2018-11-29 13:17:00, status changed: 2018-11-29 13:27:26
Settings
Chain sequence(s) A: QDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVR
Distance of aggregation 5 Å
Dynamic mode No
Mutated residues WA145A, WA142A, WA159A, FA59A, YA108A
Energy difference between WT (input) and mutated protein (by FoldX) 10.308 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-2.1654
Maximal score value
1.6572
Average score
-0.414
Total score value
-64.1641

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
23 Q A -1.2400
24 D A -0.4469
25 F A 0.0000
26 Y A 0.0000
27 D A -0.7699
28 F A -0.2576
29 K A -1.6763
30 A A 0.0000
31 V A 0.9254
32 N A -0.1225
33 I A 0.0000
34 R A -1.9287
35 G A -1.1184
36 K A -1.5030
37 L A 1.4038
38 V A 0.5427
39 S A -0.2709
40 L A 0.0000
41 E A -1.9766
42 K A -2.0047
43 Y A 0.0000
44 R A -0.6714
45 G A -0.2940
46 S A 0.0000
47 V A 0.0000
48 S A 0.0000
49 L A 0.0000
50 V A 0.0000
51 V A 0.0000
52 N A 0.0000
53 V A 0.0000
54 A A 0.0000
55 S A -0.3718
56 E A -1.8374
57 C A -0.3049
58 G A -0.4430
59 A A -0.0727 mutated: FA59A
60 T A 0.0000
61 D A -2.0095
62 Q A -1.5270
63 H A 0.0000
64 Y A 0.0000
65 R A -1.8426
66 A A -0.3307
67 L A 0.0000
68 Q A 0.0000
69 Q A -1.3916
70 L A 0.0000
71 Q A -0.4722
72 R A -2.1654
73 D A -1.2988
74 L A 0.0000
75 G A -0.1718
76 P A -0.3858
77 H A -0.8327
78 H A -1.1000
79 F A 0.0000
80 N A -0.2269
81 V A 0.0000
82 L A 0.0000
83 A A 0.0000
84 F A 0.0000
85 P A 0.0000
86 C A 0.0000
87 N A -0.5592
88 Q A -0.7140
89 F A 0.0494
90 G A -0.6355
91 Q A -1.3696
92 Q A -0.7072
93 E A 0.0000
94 P A -0.4926
95 D A -1.6265
96 S A -0.5081
97 N A -0.9494
98 K A -2.0880
99 E A -1.8188
100 I A 0.0000
101 E A 0.0000
102 S A 0.0299
103 F A 0.4241
104 A A 0.0000
105 R A -0.8945
106 R A -1.9539
107 T A -0.4130
108 A A 0.0000 mutated: YA108A
109 S A -0.2798
110 V A 0.0000
111 S A -0.2129
112 F A 0.0000
113 P A -0.0452
114 M A 0.0000
115 F A 0.0000
116 S A -0.1434
117 K A -0.5170
118 I A 0.2094
119 A A 0.0692
120 V A 0.0000
121 T A -0.0962
122 G A -0.4813
123 T A -0.2430
124 G A -0.4794
125 A A 0.0000
126 H A -0.1575
127 P A -0.3568
128 A A 0.0000
129 F A 0.0000
130 K A -1.0953
131 Y A -0.0606
132 L A 0.0000
133 A A -0.4338
134 Q A -1.2014
135 T A -0.2491
136 S A -0.1254
137 G A -0.7817
138 K A -2.1256
139 E A -2.1373
140 P A 0.0000
141 T A -0.0679
142 A A 0.0035 mutated: WA142A
143 N A 0.0000
144 F A 0.0000
145 A A 0.0000 mutated: WA145A
146 K A 0.0000
147 Y A 0.0000
148 L A 0.0000
149 V A 0.0000
150 A A -0.0024
151 P A -0.3939
152 D A -1.7978
153 G A 0.0000
154 K A -1.1773
155 V A 0.2958
156 V A 1.6572
157 G A 0.1314
158 A A -0.0030
159 A A -0.1913 mutated: WA159A
160 D A -1.1133
161 P A -0.2549
162 T A -0.0125
163 V A 0.3230
164 S A -0.0100
165 V A -0.1537
166 E A -2.1161
167 E A -2.1498
168 V A 0.0000
169 R A -0.9241
170 P A -0.5315
171 Q A -1.1161
172 I A 0.0000
173 T A -0.0312
174 A A 0.1385
175 L A 0.5206
176 V A -0.0221
177 R A -1.8004

 

Laboratory of Theory of Biopolymers 2015