Project name: SH3_S94D

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA94D
Energy difference between WT (input) and mutated protein (by FoldX)	3.60186 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4904
• Maximal score value: 1.2501
• Average score: -0.9493
• Total score value: -56.9604

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3148
90	Y	A	-0.7416
91	D	A	-2.8638
92	Y	A	-2.2014
93	E	A	-3.0457
94	D	A	-2.4852	mutated: SA94D
95	R	A	-2.9371
96	T	A	-2.2440
97	E	A	-2.3974
98	T	A	-1.2687
99	D	A	-1.3811
100	L	A	0.0000
101	S	A	-2.0204
102	F	A	0.0000
103	K	A	-3.4904
104	K	A	-2.8648
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4375
111	V	A	1.2501
112	N	A	-0.4193
113	N	A	-1.8135
114	T	A	-1.7325
115	E	A	-2.9357
116	G	A	-2.6079
117	D	A	-2.6831
118	W	A	-1.3342
119	W	A	-0.6908
120	L	A	0.4135
121	A	A	0.0000
122	H	A	-0.3837
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8788
127	G	A	-0.8169
128	Q	A	-1.4085
129	T	A	-0.4874
130	G	A	0.0000
131	Y	A	0.2016
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2846
135	N	A	-1.2482
136	Y	A	-0.2068
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1505
140	S	A	-0.1759