Project name: SH3_W119G

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	WA119G
Energy difference between WT (input) and mutated protein (by FoldX)	4.48469 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2707
• Average score: -0.8807
• Total score value: -52.841

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4412
82	S	A	-0.6738
83	H	A	-0.7912
84	M	A	0.2999
85	T	A	0.0000
86	F	A	0.0598
87	V	A	-0.5143
88	A	A	0.0000
89	L	A	-0.2391
90	Y	A	-0.7043
91	D	A	-2.8528
92	Y	A	-2.1057
93	E	A	-2.8817
94	S	A	0.0000
95	R	A	-2.7840
96	T	A	-2.1630
97	E	A	-2.3616
98	T	A	-1.2584
99	D	A	-1.3771
100	L	A	0.0000
101	S	A	-1.9144
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8365
105	G	A	-1.9278
106	E	A	0.0000
107	R	A	-2.0143
108	L	A	0.0000
109	Q	A	-0.1771
110	I	A	0.5145
111	V	A	1.2707
112	N	A	-0.4225
113	N	A	-1.8668
114	T	A	-1.7582
115	E	A	-2.9886
116	G	A	-2.6679
117	D	A	-2.7749
118	W	A	-1.4997
119	G	A	0.0000	mutated: WA119G
120	L	A	0.3295
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4120
129	T	A	-0.4965
130	G	A	0.0000
131	Y	A	0.0884
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3690
135	N	A	-1.2515
136	Y	A	-0.1313
137	V	A	-0.0387
138	A	A	0.0898
139	P	A	-0.0581
140	S	A	-0.1170