Project name: SH3_R107T

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	RA107T
Energy difference between WT (input) and mutated protein (by FoldX)	0.708767 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.2839
• Maximal score value: 1.2187
• Average score: -0.7886
• Total score value: -47.317

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4633
82	S	A	-0.6993
83	H	A	-0.8046
84	M	A	0.2408
85	T	A	0.1613
86	F	A	0.3835
87	V	A	0.0173
88	A	A	0.0000
89	L	A	-0.3128
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2408
99	D	A	-1.3222
100	L	A	0.0000
101	S	A	-1.9031
102	F	A	0.0000
103	K	A	-3.2839
104	K	A	-2.6267
105	G	A	-1.5155
106	E	A	0.0000
107	T	A	-0.2667	mutated: RA107T
108	L	A	0.0000
109	Q	A	0.0419
110	I	A	0.5657
111	V	A	1.2187
112	N	A	-0.4336
113	N	A	-1.8138
114	T	A	-1.7326
115	E	A	-2.9361
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3421
119	W	A	-0.7001
120	L	A	0.3876
121	A	A	0.0000
122	H	A	-0.1674
123	S	A	0.0000
124	L	A	0.3089
125	T	A	-0.2069
126	T	A	-0.6121
127	G	A	-0.7887
128	Q	A	-1.4009
129	T	A	-0.5049
130	G	A	0.0000
131	Y	A	0.2167
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2855
135	N	A	-1.2485
136	Y	A	-0.2041
137	V	A	0.0000
138	A	A	-0.0240
139	P	A	0.0353
140	S	A	0.1052