Project name: SH3_N112P

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	NA112P
Energy difference between WT (input) and mutated protein (by FoldX)	3.88239 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.4399
• Average score: -0.863
• Total score value: -51.7807

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4578
82	S	A	-0.6843
83	H	A	-0.7924
84	M	A	0.2647
85	T	A	0.0000
86	F	A	-0.1071
87	V	A	-0.6237
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1458
97	E	A	-2.3442
98	T	A	-1.2232
99	D	A	-1.2930
100	L	A	0.0000
101	S	A	-1.8931
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0748
108	L	A	0.0000
109	Q	A	-0.2188
110	I	A	0.5500
111	V	A	1.4399
112	P	A	0.0438	mutated: NA112P
113	N	A	-1.5852
114	T	A	-1.5974
115	E	A	-2.8555
116	G	A	-2.5612
117	D	A	-2.6784
118	W	A	-1.2641
119	W	A	-0.5414
120	L	A	0.5886
121	A	A	0.0000
122	H	A	-0.3448
123	S	A	0.0000
124	L	A	-0.2839
125	T	A	-0.7813
126	T	A	-0.8791
127	G	A	-0.8186
128	Q	A	-1.4141
129	T	A	-0.4924
130	G	A	0.0000
131	Y	A	0.3485
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2784
135	N	A	-1.2490
136	Y	A	-0.2043
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1516
140	S	A	-0.1759