Project name: 1BK2

Chain sequence(s)	A: KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNGRQGFVPAAYVKKLD
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -3.2011
• Maximal score value: 0.8705
• Average score: -1.2108
• Total score value: -69.0133

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
6	K	A	-1.8634
7	E	A	-1.3130
8	L	A	0.0220
9	V	A	0.0000
10	L	A	0.2095
11	A	A	0.0000
12	L	A	-0.2080
13	Y	A	-0.7545
14	D	A	-2.9360
15	Y	A	0.0000
16	Q	A	-2.5803
17	E	A	-2.4456
18	K	A	-2.6958
19	S	A	-1.8233
20	P	A	-1.5292
21	R	A	-2.2281
22	E	A	0.0000
23	V	A	0.0000
24	T	A	-2.2834
25	M	A	0.0000
26	K	A	-3.2011
27	K	A	-2.6128
28	G	A	-1.3837
29	D	A	-0.8708
30	I	A	0.8705
31	L	A	0.0000
32	T	A	-0.5339
33	L	A	0.0000
34	L	A	-0.7509
35	N	A	-1.1529
36	S	A	-1.4591
37	T	A	-1.4008
38	N	A	-2.5876
39	K	A	-3.0410
40	D	A	-2.7346
41	W	A	-1.4235
42	W	A	-0.9495
43	K	A	-1.1257
44	V	A	0.0000
45	E	A	-1.9369
46	V	A	-1.8265
47	N	A	-2.2282
48	G	A	-2.3855
49	R	A	-3.1604
50	Q	A	-2.8040
51	G	A	0.0000
52	F	A	-1.0809
53	V	A	0.0000
54	P	A	-0.5488
55	A	A	-1.1607
56	A	A	-0.2277
57	Y	A	0.1905
58	V	A	0.0000
59	K	A	-1.0176
60	K	A	-1.3652
61	L	A	-0.6272
62	D	A	-2.0477