Project name: SH3 1FMK domain

Status: done

submitted: 2019-03-14 10:53:28, status changed: 2019-03-14 10:56:54
Settings
Chain sequence(s) A: MVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDS
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.4965
Maximal score value
1.503
Average score
-0.8117
Total score value
-49.5154

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
82 M A 1.5030
83 V A 1.3610
84 T A 0.4065
85 T A -0.1379
86 F A 0.0000
87 V A -0.9776
88 A A 0.0000
89 L A -0.2577
90 Y A -0.7834
91 D A -2.9711
92 Y A 0.0000
93 E A -3.0595
94 S A -2.2309
95 R A -2.8350
96 T A -2.0684
97 E A -2.2572
98 T A -1.0893
99 D A -0.9895
100 L A 0.0000
101 S A -1.8484
102 F A 0.0000
103 K A -3.4965
104 K A -2.7789
105 G A -1.7096
106 E A 0.0000
107 R A -1.8700
108 L A 0.0000
109 Q A 0.0525
110 I A 0.0000
111 V A 1.3306
112 N A -0.8179
113 N A -1.5774
114 T A -1.7944
115 E A -2.7123
116 G A -2.4396
117 D A -2.2852
118 W A -0.4134
119 W A -0.0759
120 L A 0.8983
121 A A 0.0000
122 H A -0.6348
123 S A 0.0000
124 L A 0.4676
125 S A -0.2358
126 T A -0.6032
127 G A -0.7703
128 Q A -1.4149
129 T A -0.6347
130 G A 0.0000
131 Y A 0.7288
132 I A 0.0000
133 P A -0.3198
134 S A -1.1189
135 N A -1.1562
136 Y A -0.1205
137 V A 0.0000
138 A A -0.4847
139 P A -0.9648
140 S A -1.3017
141 D A -1.9189
142 S A -1.1075

 

Laboratory of Theory of Biopolymers 2015