Project name: SH3_R107N

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	RA107N
Energy difference between WT (input) and mutated protein (by FoldX)	0.896123 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.3354
• Maximal score value: 1.2191
• Average score: -0.8161
• Total score value: -48.9681

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4590
82	S	A	-0.6935
83	H	A	-0.8003
84	M	A	0.2485
85	T	A	0.0651
86	F	A	0.2545
87	V	A	-0.1600
88	A	A	0.0000
89	L	A	-0.3184
90	Y	A	-0.7393
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2413
99	D	A	-1.3228
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.3354
104	K	A	-2.6882
105	G	A	-1.6318
106	E	A	0.0000
107	N	A	-0.6983	mutated: RA107N
108	L	A	0.0000
109	Q	A	-0.0198
110	I	A	0.5286
111	V	A	1.2191
112	N	A	-0.4339
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.7048
120	L	A	0.3827
121	A	A	0.0000
122	H	A	-0.2440
123	S	A	0.0000
124	L	A	0.2263
125	T	A	-0.3215
126	T	A	-0.6668
127	G	A	-0.7910
128	Q	A	-1.4080
129	T	A	-0.5140
130	G	A	0.0000
131	Y	A	0.2104
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2857
135	N	A	-1.2485
136	Y	A	-0.2074
137	V	A	0.0000
138	A	A	-0.0307
139	P	A	-0.0157
140	S	A	0.0289