Project name: bind3

Status: done

submitted: 2018-10-31 19:22:59, status changed: 2018-11-24 16:04:12
Settings
Chain sequence(s) A: MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Distance of aggregation 10 Å
Dynamic mode Yes
Show buried residues

Minimal score value
-4.3805
Maximal score value
1.7387
Average score
-0.7762
Total score value
-103.2333

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.5536
2 V A 1.6301
3 D A -0.9700
4 A A 0.1517
5 F A 1.7387
6 L A 1.5843
7 G A 0.0000
8 T A -0.7305
9 W A 0.0000
10 K A -2.4617
11 L A 0.0000
12 V A 0.2759
13 D A -0.3074
14 S A -0.7271
15 K A -2.0517
16 N A -1.5098
17 F A -0.8561
18 D A -1.3344
19 D A -1.6876
20 Y A 0.0000
21 M A 0.0000
22 K A -1.6105
23 S A -0.6436
24 L A 0.4159
25 G A -0.2046
26 V A 0.5148
27 G A 0.4444
28 F A 1.3754
29 A A 0.8710
30 T A 0.6256
31 R A -0.0081
32 Q A 0.3653
33 V A 1.4584
34 A A 0.0000
35 S A 0.2700
36 M A 1.0966
37 T A 0.1405
38 K A -1.3787
39 P A -1.0450
40 T A -1.1400
41 T A 0.0000
42 I A -0.3002
43 I A 0.0000
44 E A 0.0048
45 K A -0.9867
46 N A -1.1970
47 G A -1.6515
48 D A -2.7671
49 I A -1.8992
50 L A 0.0000
51 T A 0.0000
52 L A -0.3020
53 K A -1.1433
54 T A -1.3179
55 H A -1.6652
56 S A -1.0490
57 T A -0.2545
58 F A 0.5691
59 K A -1.6492
60 N A -2.4263
61 T A -1.9332
62 E A -1.8557
63 I A -0.1512
64 S A -0.3020
65 F A 0.0000
66 K A -2.1325
67 L A -1.3062
68 G A -1.0564
69 V A -0.8516
70 E A -1.4411
71 F A -0.3020
72 D A -2.2836
73 E A -2.2546
74 T A -2.4374
75 T A -2.3998
76 A A -2.0324
77 D A -3.2001
78 D A -3.7508
79 R A -3.6746
80 K A -4.3805
81 V A 0.0000
82 K A -2.9326
83 S A -1.1247
84 I A -0.3844
85 V A 0.0000
86 T A -0.1641
87 L A -0.2067
88 D A -1.9202
89 G A -1.4195
90 G A -1.2087
91 K A -0.9391
92 L A 0.0000
93 V A 0.8048
94 H A 0.0000
95 L A -0.3619
96 Q A -1.6676
97 K A -3.2119
98 W A -3.0232
99 D A -3.9468
100 G A -2.8616
101 Q A -3.0318
102 E A -3.1350
103 T A 0.0000
104 T A -0.3913
105 L A 0.0000
106 V A 1.0487
107 R A 0.0000
108 E A -0.0827
109 L A 0.0658
110 I A 0.6057
111 D A -1.2549
112 G A -1.1826
113 K A -2.0567
114 L A 0.0000
115 I A 1.5581
116 L A 0.0000
117 T A 0.5403
118 L A 0.0000
119 T A -0.0962
120 H A -0.8656
121 G A -1.1267
122 T A -0.2790
123 A A -0.3002
124 V A 0.1308
125 C A 0.0000
126 T A 0.0000
127 R A -0.0828
128 T A -0.3382
129 Y A 0.0000
130 E A -2.9764
131 K A -2.8400
132 E A -2.1848
133 A A -0.4541

Above is the comparison between the input structure and the most aggregation prone model (predicted in the flexibility simulations, download both models in the PDB file format , download table with rmsd values ). The picture presents the most aggregation prone model (in blue) superimposed on the input structure (in red). The plot shows rmsd profile (distances between residues of the superimposed structures).

Dynamic mode uses CABS-flex simulations of protein structure fluctuations. The structure fluctuations may have impact on the size and extent of aggregation "hot-spots" on the protein surface. The dynamic mode uses the following pipeline: (1) based on the input structure, CABS-flex predicts a set of different models reflecting protein dynamics in solution; (2) for each of these models A3D score is calculated; (3) finally, the most aggregation prone model (the model with the highest A3D score, -0.7762 in this case) is selected and presented in A3D results.


 

Laboratory of Theory of Biopolymers 2015