Project name: SH3_I110E

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	IA110E
Energy difference between WT (input) and mutated protein (by FoldX)	3.94246 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 0.8512
• Average score: -0.9749
• Total score value: -58.4957

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.5956
82	S	A	-0.8310
83	H	A	-0.8815
84	M	A	-0.0879
85	T	A	0.0000
86	F	A	0.0000
87	V	A	-0.7219
88	A	A	0.0000
89	L	A	-0.3370
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1057
93	E	A	-2.8817
94	S	A	0.0000
95	R	A	-2.7840
96	T	A	-2.1637
97	E	A	-2.3623
98	T	A	-1.2597
99	D	A	-1.3599
100	L	A	0.0000
101	S	A	-1.9153
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9867
106	E	A	0.0000
107	R	A	-2.2159
108	L	A	0.0000
109	Q	A	-0.7470
110	E	A	-0.4769	mutated: IA110E
111	V	A	0.8512
112	N	A	-0.6328
113	N	A	-1.9985
114	T	A	-1.7245
115	E	A	-2.9375
116	G	A	-2.6162
117	D	A	-2.7120
118	W	A	-1.3923
119	W	A	-0.9175
120	L	A	0.1729
121	A	A	0.0000
122	H	A	-0.5983
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4120
129	T	A	-0.5944
130	G	A	0.0000
131	Y	A	0.0432
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3977
135	N	A	-1.2540
136	Y	A	-0.2295
137	V	A	0.0000
138	A	A	-0.0883
139	P	A	-0.3658
140	S	A	-0.2883