Project name: 10-7pig [mutate: IL24S, SL26Q, AL51G, LL55R, LL56A, GH166S]

Status: done

submitted: 2019-03-18 04:40:05, status changed: 2019-03-18 04:51:51
Settings
Chain sequence(s) H: QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYSVHWVRQAPGQGLEWMGVINTYGGNTDYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGYGSWLAYWGQGTTLTVSS
L: DIQMTQSPSSLSASVGDRVTITCIVSSSISSSGLHWYQQKPEKAPKSLIFATSNLLSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHWSSYPLTFGAGTKLEIKRTV
Distance of aggregation 5 Å
Dynamic mode No
Mutated residues IL24S, SL26Q, AL51G, LL55R, LL56A, GH166S
Energy difference between WT (input) and mutated protein (by FoldX) 1.47259 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-2.1691
Maximal score value
1.7596
Average score
-0.2695
Total score value
-61.1834

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D L -1.7507
2 I L -0.3335
3 Q L -1.1596
4 M L 0.0000
5 T L -0.0619
6 Q L 0.0000
7 S L -0.2416
8 P L -0.1999
9 S L -0.2690
10 S L -0.3841
11 L L 0.1302
12 S L -0.1736
13 A L -0.0419
14 S L -0.0252
15 V L 1.2154
16 G L -0.2048
17 D L -1.2481
18 R L -2.0135
19 V L 0.0000
20 T L -0.0725
21 I L 0.0000
22 T L -0.0314
23 C L 0.0000
24 S L -0.2500 mutated: IL24S
25 V L 0.0000
26 Q L -1.2375 mutated: SL26Q
27 S L -0.4728
28 S L -0.2255
29 I L 0.1387
30 S L -0.2110
31 S L -0.1662
32 S L -0.2391
33 G L -0.0988
34 L L 0.0000
35 H L -0.0325
36 W L 0.0000
37 Y L 0.0000
38 Q L 0.0000
39 Q L -0.2293
40 K L -0.5196
41 P L -0.6085
42 E L -2.1416
43 K L -1.8885
44 A L -0.2704
45 P L 0.0000
46 K L -1.1014
47 S L -0.2241
48 L L 0.0000
49 I L 0.0000
50 F L 0.4993
51 G L 0.0075 mutated: AL51G
52 T L 0.0000
53 S L -0.3828
54 N L -1.4310
55 R L -1.0161 mutated: LL55R
56 A L -0.1787 mutated: LL56A
57 S L -0.2964
58 G L -0.4690
59 V L 0.0916
60 P L -0.1139
61 S L -0.2974
62 R L -0.3907
63 F L 0.0000
64 S L -0.1139
65 G L -0.1180
66 S L -0.1790
67 G L -0.3084
68 S L -0.2844
69 G L -0.1650
70 T L -0.3841
71 D L -1.7961
72 F L 0.0000
73 T L -0.0158
74 L L 0.0000
75 T L -0.0222
76 I L 0.0000
77 S L -0.3562
78 S L -0.2607
79 L L 0.0000
80 Q L -0.4803
81 P L -0.6453
82 E L -1.6270
83 D L 0.0000
84 F L 0.7442
85 A L 0.0000
86 T L -0.2077
87 Y L 0.0000
88 Y L 0.0000
89 C L 0.0000
90 Q L 0.0000
91 H L 0.0000
92 W L 0.0986
93 S L -0.1369
94 S L 0.0030
95 Y L 1.2542
96 P L 0.2758
97 L L 0.0000
98 T L 0.0219
99 F L 0.1887
100 G L 0.0000
101 A L 0.0585
102 G L 0.0000
103 T L 0.0000
104 K L -1.3391
105 L L 0.0000
106 E L -0.9960
107 I L -0.2274
108 K L -1.9938
109 R L -2.1691
110 T L -0.0808
111 V L 1.7596
112 Q H -1.1037
113 V H 0.0069
114 Q H -1.1045
115 L H 0.0000
116 V H 0.6286
117 Q H 0.0000
118 S H -0.2604
119 G H -0.4877
120 A H -0.3297
121 E H -1.2494
122 V H 1.3699
123 K H -0.5588
124 K H -1.8465
125 P H -0.6201
126 G H -0.5327
127 A H -0.0914
128 S H -0.1551
129 V H 0.0000
130 K H -1.7218
131 V H 0.0000
133 C H 0.0000
134 K H -0.7904
135 A H 0.0000
136 S H -0.1453
137 G H -0.3548
138 Y H 0.1113
139 T H -0.0325
140 F H 0.0000
141 T H -0.3867
142 D H -1.7536
143 Y H -0.0761
144 S H -0.0206
145 V H 0.0000
146 H H 0.0000
147 W H 0.0000
148 V H 0.0000
149 R H 0.0000
150 Q H -0.1281
151 A H -0.0578
152 P H -0.3380
153 G H -0.7318
154 Q H -1.2835
155 G H 0.0000
156 L H 0.0000
157 E H -0.2717
158 W H 0.0000
159 M H 0.0000
160 G H 0.0000
161 V H 0.1782
162 I H 0.0000
163 N H -0.2697
164 T H 0.0000
165 Y H 1.2762
166 S H 0.0015 mutated: GH166S
167 G H -0.4188
168 N H -1.3024
169 T H -0.5823
170 D H -1.7528
171 Y H -0.1138
172 A H -0.1745
173 Q H -1.5066
174 K H -1.9180
175 F H 0.0000
176 Q H -1.2832
177 G H -0.7495
178 R H -0.4424
179 V H 0.0000
180 T H -0.0458
181 M H 0.0000
182 T H -0.1096
183 R H -0.5664
184 D H -0.8319
185 T H -0.2458
186 S H -0.2387
187 T H -0.1195
188 S H -0.0664
189 T H 0.0000
190 V H 0.0000
191 Y H 0.2828
192 M H 0.0000
193 E H -1.0205
194 L H 0.0000
195 S H -0.1467
196 S H -0.2917
197 L H 0.0000
198 R H -1.8263
199 S H -0.8728
200 E H -1.8588
201 D H 0.0000
202 T H -0.0206
203 A H 0.0000
204 V H 0.3036
205 Y H 0.0000
206 Y H 0.0000
207 C H 0.0000
208 A H 0.0000
209 R H 0.0000
210 G H 0.0000
211 Y H 1.0854
212 G H -0.0784
213 S H -0.2185
214 W H 0.1821
215 L H 0.0000
216 A H 0.1644
217 Y H 0.8596
218 W H 0.0000
219 G H -0.2910
220 Q H -1.2181
221 G H -0.2741
222 T H 0.0000
223 T H -0.0056
224 L H 0.0000
225 T H 0.1659
226 V H 0.0000
227 S H -0.1488
228 S H -0.2330

 

Laboratory of Theory of Biopolymers 2015