Project name: SH3_W118E

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	WA118E
Energy difference between WT (input) and mutated protein (by FoldX)	2.23525 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.7211
• Maximal score value: 1.2416
• Average score: -1.0809
• Total score value: -64.8562

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1038
87	V	A	-0.6194
88	A	A	0.0000
89	L	A	-0.2946
90	Y	A	-0.7011
91	D	A	-2.8102
92	Y	A	-2.0609
93	E	A	-2.8779
94	S	A	0.0000
95	R	A	-2.8157
96	T	A	-2.2287
97	E	A	-2.4229
98	T	A	-1.3677
99	D	A	-1.8207
100	L	A	0.0000
101	S	A	-1.9449
102	F	A	0.0000
103	K	A	-3.4621
104	K	A	-2.8424
105	G	A	-1.9589
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2478
110	I	A	0.4275
111	V	A	1.2416
112	N	A	-0.7035
113	N	A	-2.2397
114	T	A	-2.0204
115	E	A	-3.5067
116	G	A	-3.1976
117	D	A	-3.7211
118	E	A	-3.4949	mutated: WA118E
119	W	A	-1.7841
120	L	A	-0.1402
121	A	A	0.0000
122	H	A	-0.3977
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4329
129	T	A	-0.5518
130	G	A	0.0000
131	Y	A	-0.5585
132	I	A	0.0000
133	P	A	-1.4191
134	S	A	-1.9848
135	N	A	-1.5489
136	Y	A	-0.4128
137	V	A	0.0000
138	A	A	-0.0203
139	P	A	-0.1505
140	S	A	-0.1759