Project name: SH3_N112T

Status: done

submitted: 2019-03-14 15:26:36, status changed: 2019-03-14 17:17:09
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues NA112T
Energy difference between WT (input) and mutated protein (by FoldX) 1.3027 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4774
Maximal score value
1.4976
Average score
-0.8263
Total score value
-49.5777

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4506
82 S A -0.6820
83 H A -0.7908
84 M A 0.2676
85 T A 0.0000
86 F A -0.1038
87 V A -0.6187
88 A A 0.0000
89 L A -0.2999
90 Y A -0.7095
91 D A -2.8409
92 Y A -2.1029
93 E A -2.8836
94 S A 0.0000
95 R A -2.7844
96 T A -2.1785
97 E A -2.3772
98 T A -1.2950
99 D A -1.4198
100 L A 0.0000
101 S A -1.9350
102 F A 0.0000
103 K A -3.4774
104 K A -2.8504
105 G A -1.9568
106 E A 0.0000
107 R A -2.0707
108 L A 0.0000
109 Q A -0.1765
110 I A 0.5739
111 V A 1.4976
112 T A 0.2342 mutated: NA112T
113 N A -1.3031
114 T A -1.1797
115 E A -2.0343
116 G A -2.1704
117 D A -2.4985
118 W A -1.1543
119 W A -0.4202
120 L A 0.6296
121 A A 0.0000
122 H A -0.3485
123 S A 0.0000
124 L A -0.2788
125 T A -0.7803
126 T A -0.8779
127 G A -0.8168
128 Q A -1.4119
129 T A -0.5322
130 G A 0.0000
131 Y A 0.0711
132 I A 0.0000
133 P A 0.0000
134 S A -1.2329
135 N A -1.2543
136 Y A -0.2053
137 V A 0.0000
138 A A -0.0219
139 P A -0.1501
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015