Project name: SH3_F86M

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	FA86M
Energy difference between WT (input) and mutated protein (by FoldX)	0.977279 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2321
• Average score: -0.9155
• Total score value: -54.9329

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.5047
82	S	A	-0.7530
83	H	A	-0.9009
84	M	A	-0.0084
85	T	A	0.0000
86	M	A	0.0000	mutated: FA86M
87	V	A	-0.7218
88	A	A	0.0000
89	L	A	-0.3370
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3213
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9867
106	E	A	0.0000
107	R	A	-2.1337
108	L	A	0.0000
109	Q	A	-0.3661
110	I	A	0.3252
111	V	A	1.2321
112	N	A	-0.4277
113	N	A	-1.8184
114	T	A	-1.7302
115	E	A	-2.9330
116	G	A	-2.6057
117	D	A	-2.6813
118	W	A	-1.3358
119	W	A	-0.6938
120	L	A	0.4000
121	A	A	0.0000
122	H	A	-0.3930
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4993
130	G	A	0.0000
131	Y	A	0.2194
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2865
135	N	A	-1.2470
136	Y	A	-0.2258
137	V	A	0.0000
138	A	A	-0.0882
139	P	A	-0.2900
140	S	A	-0.2966