Project name: SH3_S101N

Status: done

submitted: 2019-03-14 15:20:24, status changed: 2019-03-14 16:36:54
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues SA101N
Energy difference between WT (input) and mutated protein (by FoldX) 0.886786 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.7259
Maximal score value
1.2498
Average score
-0.9993
Total score value
-59.9596

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1044
87 V A -0.6223
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -3.0590
92 Y A -2.4895
93 E A -3.3669
94 S A -2.6073
95 R A -2.9692
96 T A -2.2955
97 E A -2.3562
98 T A -1.3712
99 D A -1.6001
100 L A 0.0000
101 N A -3.0813 mutated: SA101N
102 F A 0.0000
103 K A -3.7259
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -2.0714
108 L A 0.0000
109 Q A -0.2491
110 I A 0.4372
111 V A 1.2498
112 N A -0.4200
113 N A -1.8142
114 T A -1.7328
115 E A -2.9363
116 G A -2.6085
117 D A -2.6844
118 W A -1.3422
119 W A -0.6976
120 L A 0.4049
121 A A 0.0000
122 H A -0.3604
123 S A 0.0000
124 L A -0.2642
125 T A -0.7669
126 T A -0.9779
127 G A -0.7757
128 Q A -1.5171
129 T A -0.6239
130 G A 0.0000
131 Y A 0.0565
132 I A 0.0000
133 P A 0.0000
134 S A -1.2857
135 N A -1.2485
136 Y A -0.2039
137 V A 0.0000
138 A A -0.0212
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015