Project name: SH3_H122P

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	HA122P
Energy difference between WT (input) and mutated protein (by FoldX)	4.79209 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.244
• Average score: -0.8827
• Total score value: -52.961

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4617
82	S	A	-0.6883
83	H	A	-0.7958
84	M	A	0.2595
85	T	A	0.0000
86	F	A	-0.1137
87	V	A	-0.6277
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1552
97	E	A	-2.3537
98	T	A	-1.2447
99	D	A	-1.3282
100	L	A	0.0000
101	S	A	-1.9051
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0168
108	L	A	0.0000
109	Q	A	-0.2076
110	I	A	0.4502
111	V	A	1.2440
112	N	A	-0.4007
113	N	A	-1.8126
114	T	A	-1.7305
115	E	A	-2.9315
116	G	A	-2.6056
117	D	A	-2.6857
118	W	A	-1.3423
119	W	A	-0.6834
120	L	A	0.4266
121	A	A	0.0000
122	P	A	-0.1951	mutated: HA122P
123	S	A	0.0000
124	L	A	-0.1346
125	T	A	-0.7070
126	T	A	-0.8320
127	G	A	-0.7675
128	Q	A	-1.3541
129	T	A	-0.4222
130	G	A	0.0000
131	Y	A	0.2331
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2871
135	N	A	-1.2486
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1542
140	S	A	-0.1759