Project name: SH3_S82L

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA82L
Energy difference between WT (input) and mutated protein (by FoldX)	0.0378959 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.319
• Average score: -0.8034
• Total score value: -48.2065

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	0.4382
82	L	A	1.1154	mutated: SA82L
83	H	A	0.0908
84	M	A	0.8312
85	T	A	0.0000
86	F	A	-0.0428
87	V	A	-0.5905
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2413
99	D	A	-1.3228
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0151
108	L	A	0.0000
109	Q	A	0.2718
110	I	A	0.7529
111	V	A	1.3190
112	N	A	-0.3895
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.6964
120	L	A	0.4415
121	A	A	0.0000
122	H	A	-0.2833
123	S	A	0.0000
124	L	A	-0.2154
125	T	A	-0.7738
126	T	A	-0.8731
127	G	A	-0.8105
128	Q	A	-1.4061
129	T	A	-0.4594
130	G	A	0.0000
131	Y	A	0.2217
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2857
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1250
140	S	A	-0.1759