Project name: SH3_L124H

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA124H
Energy difference between WT (input) and mutated protein (by FoldX)	2.17649 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2497
• Average score: -0.9963
• Total score value: -59.7781

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4485
82	S	A	-0.6793
83	H	A	-0.7888
84	M	A	0.2711
85	T	A	0.0000
86	F	A	-0.0989
87	V	A	-0.6195
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2408
99	D	A	-1.3222
100	L	A	0.0000
101	S	A	-1.9031
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.6524
108	L	A	0.0000
109	Q	A	-0.6394
110	I	A	0.4411
111	V	A	1.2497
112	N	A	-0.4200
113	N	A	-1.8138
114	T	A	-1.7326
115	E	A	-2.9361
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3421
119	W	A	-0.7001
120	L	A	0.4035
121	A	A	0.0000
122	H	A	-0.8929
123	S	A	0.0000
124	H	A	-2.1721	mutated: LA124H
125	T	A	-1.7074
126	T	A	-1.4478
127	G	A	-1.4440
128	Q	A	-1.7573
129	T	A	-0.7382
130	G	A	0.0000
131	Y	A	0.2167
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2855
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1482
140	S	A	-0.1759