Project name: SH3_Y136K

Status: done

submitted: 2019-03-14 17:17:53, status changed: 2019-03-14 18:57:48
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues YA136K
Energy difference between WT (input) and mutated protein (by FoldX) 1.58563 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4532
Maximal score value
1.2498
Average score
-0.9377
Total score value
-56.2649

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1730
87 V A -0.7017
88 A A 0.0000
89 L A -0.4628
90 Y A -0.7950
91 D A -2.8918
92 Y A -2.1734
93 E A -2.8783
94 S A 0.0000
95 R A -2.7830
96 T A -2.1540
97 E A -2.3526
98 T A -1.2414
99 D A -1.3262
100 L A 0.0000
101 S A -1.9013
102 F A 0.0000
103 K A -3.4532
104 K A -2.9000
105 G A -1.9412
106 E A 0.0000
107 R A -2.0714
108 L A 0.0000
109 Q A -0.2491
110 I A 0.4381
111 V A 1.2498
112 N A -0.4200
113 N A -1.8130
114 T A -1.7328
115 E A -2.9353
116 G A -2.6107
117 D A -2.6904
118 W A -1.4171
119 W A -0.7032
120 L A 0.4016
121 A A 0.0000
122 H A -0.3840
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8780
127 G A -0.8169
128 Q A -1.4119
129 T A -0.4950
130 G A 0.0000
131 Y A 0.2139
132 I A 0.0000
133 P A -0.7601
134 S A -1.4977
135 N A -1.5468
136 K A -0.8114 mutated: YA136K
137 V A 0.0000
138 A A -0.1503
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015