Project name: SH3_I110A

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	IA110A
Energy difference between WT (input) and mutated protein (by FoldX)	3.30958 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.1104
• Average score: -0.9222
• Total score value: -55.33

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4929
82	S	A	-0.7213
83	H	A	-0.7932
84	M	A	0.2183
85	T	A	0.0000
86	F	A	-0.1603
87	V	A	-0.6182
88	A	A	0.0000
89	L	A	-0.3109
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1057
93	E	A	-2.8817
94	S	A	0.0000
95	R	A	-2.7840
96	T	A	-2.1647
97	E	A	-2.3633
98	T	A	-1.2611
99	D	A	-1.3614
100	L	A	0.0000
101	S	A	-1.9165
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9605
106	E	A	0.0000
107	R	A	-2.1055
108	L	A	0.0000
109	Q	A	-0.4146
110	A	A	0.1178	mutated: IA110A
111	V	A	1.1104
112	N	A	-0.4707
113	N	A	-1.8706
114	T	A	-1.7184
115	E	A	-2.9323
116	G	A	-2.6130
117	D	A	-2.7105
118	W	A	-1.3867
119	W	A	-0.7833
120	L	A	0.3235
121	A	A	0.0000
122	H	A	-0.4778
123	S	A	0.0000
124	L	A	-0.2854
125	T	A	-0.7813
126	T	A	-0.8791
127	G	A	-0.8186
128	Q	A	-1.4142
129	T	A	-0.5452
130	G	A	0.0000
131	Y	A	0.1030
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3381
135	N	A	-1.2529
136	Y	A	-0.2062
137	V	A	0.0000
138	A	A	-0.0168
139	P	A	-0.1801
140	S	A	-0.1711