Project name: stfB

Status: done

submitted: 2019-01-30 10:50:59, status changed: 2019-01-30 11:56:40
Settings
Chain sequence(s) I: MMSGAPSATQPATAETQHIADQVRSQLEEKYNKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.1432
Maximal score value
1.9505
Average score
-0.9524
Total score value
-93.3347

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
6 M I 1.4454
7 M I 1.3568
8 S I 0.5791
9 G I 0.3720
10 A I 0.4726
11 P I 0.4241
12 S I -0.1012
13 A I -0.3113
14 T I -0.8064
15 Q I -0.9992
16 P I -0.5860
17 A I -0.9165
18 T I -0.9360
19 A I -1.1849
20 E I -2.3347
21 T I 0.0000
22 Q I -2.1738
23 H I -2.7239
24 I I -1.6936
25 A I 0.0000
26 D I -3.1499
27 Q I -2.4095
28 V I 0.0000
29 R I -2.2555
30 S I -2.2602
31 Q I -2.0570
32 L I 0.0000
33 E I 0.0000
34 E I -3.7302
35 K I -2.9412
36 Y I -2.2030
37 N I -3.2749
38 K I -3.6064
39 K I -2.9888
40 F I -1.3495
43 P I -0.5818
44 V I -0.1696
45 F I 0.0000
46 K I -1.8527
47 A I 0.0000
48 V I -0.5363
49 S I -0.7337
50 F I -0.1717
51 K I -0.2292
52 S I 0.3679
53 Q I 0.0000
54 V I 1.9505
55 V I 1.6780
56 A I 1.0863
57 G I 0.0000
58 T I 1.1532
59 N I 0.0000
60 Y I 0.5054
61 F I 0.0000
62 I I 0.0000
63 K I 0.0000
64 V I 0.0000
65 H I -1.9565
66 V I 0.0000
67 G I -2.4710
68 D I -3.3462
92 E I -4.1432
93 D I -4.1012
94 F I 0.0000
95 V I 0.0000
96 H I 0.0000
97 L I 0.0000
98 R I -0.1541
99 V I 0.0000
100 F I 0.3174
101 Q I -0.2430
102 S I -0.8218
102A L I -0.2704
103 P I -1.4447
104 H I -2.1888
105 E I -3.1065
105A N I -3.1600
106 K I -2.9338
107 P I -1.6968
108 L I -0.6989
109 T I -0.5160
110 L I 0.0000
111 S I -0.4630
112 N I -0.7167
113 Y I -0.4600
114 Q I -0.7759
115 T I -1.0734
115A N I -2.1969
116 K I -2.6749
117 A I -2.9288
118 K I -3.1760
119 H I -2.6326
120 D I -2.7962
121 E I -2.6607
122 L I 0.0000
123 T I -0.0119
124 Y I 1.2122
125 F I 0.8329

 

Laboratory of Theory of Biopolymers 2015