Project name: Ankit Mr Gupta [mutate: WA67A, WA174A]

Status: done

submitted: 2018-11-15 13:55:03, status changed: 2018-11-15 14:05:14
Settings
Chain sequence(s) A: MEGESSISIGYAQSRVKEDGYKLDKNPRGFNLKYRYEFNNDWGVIGSFAQTRRGFEESVLIDGDFKYYSVTAGPVFRINEYVSLYGLLGAGHGKAKFSSFGQSESRSKTSLAYGAGLQFNPHPNFVIDASYEYSKLDDVKVGTWMLGAGYRF
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues WA67A, WA174A
Energy difference between WT (input) and mutated protein (by FoldX) 2.92439 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.6247
Maximal score value
3.2667
Average score
-0.1913
Total score value
-29.0701

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
26 M A -1.2510
27 E A -2.1624
28 G A -0.7019
29 E A -0.1144
30 S A 0.0000
31 S A 0.0000
32 I A 2.7200
33 S A 0.0000
34 I A 3.2667
35 G A 2.5241
36 Y A 2.1567
37 A A 0.0000
38 Q A -1.6368
39 S A 0.0000
40 R A -2.9142
41 V A 0.0000
42 K A -2.5547
43 E A -2.6671
44 D A -2.6543
45 G A -1.2370
46 Y A -0.4986
47 K A -1.7523
48 L A -1.8547
49 D A -2.2777
50 K A -3.5726
51 N A -3.3841
52 P A 0.0000
53 R A -3.0925
54 G A -0.9028
55 F A 1.6139
56 N A 0.0000
57 L A 2.4982
58 K A 0.0000
59 Y A 2.1075
60 R A 0.0000
61 Y A 1.4408
62 E A 0.0000
63 F A 0.6497
64 N A -1.6384
65 N A -2.0962
66 D A -1.7184
67 A A 0.0577 mutated: WA67A
68 G A 0.0000
69 V A 1.6004
70 I A 0.0000
71 G A 1.2075
72 S A 0.0000
73 F A 1.9245
74 A A 0.0000
75 Q A -0.1661
76 T A 0.0000
77 R A -3.5310
78 R A -3.4646
79 G A -2.2433
80 F A -0.6302
81 E A -2.2619
82 E A -2.0228
83 S A -0.4936
84 V A 1.1019
89 L A 2.5135
90 I A 2.1762
91 D A -0.4206
92 G A -1.4181
93 D A -2.4565
94 F A -2.3094
95 K A -2.5514
96 Y A 0.0000
97 Y A 0.3768
98 S A 0.0000
99 V A 2.4839
100 T A 0.0000
101 A A 1.0988
102 G A 0.4166
103 P A 0.7710
104 V A 0.0000
105 F A 2.0169
106 R A 0.0000
107 I A 1.3922
108 N A -0.2754
109 E A -1.3532
110 Y A 0.7151
111 V A 1.7420
112 S A 0.0000
113 L A 2.1576
114 Y A 0.0000
115 G A 0.8143
116 L A 0.0000
117 L A 2.1600
118 G A 1.7010
119 A A 1.4663
120 G A 0.0000
121 H A -0.3881
122 G A 0.0000
123 K A -2.3282
124 A A -2.5148
125 K A -2.6578
126 F A -1.1683
127 S A -0.4326
128 S A 1.0394
130 F A 1.8079
131 G A -0.1725
132 Q A -0.9954
133 S A -1.4941
134 E A -2.7220
135 S A -2.6083
136 R A -2.9136
137 S A -2.2759
138 K A -2.0191
139 T A -0.7885
140 S A -0.3033
141 L A 1.4680
142 A A 0.0000
143 Y A 1.8223
144 G A 0.9685
145 A A 0.7987
146 G A 0.8099
147 L A 1.7791
148 Q A 0.0000
149 F A 1.5450
150 N A 0.0000
151 P A -0.1627
152 H A -0.8687
153 P A -0.4235
154 N A 0.0233
155 F A 1.0437
156 V A 0.0000
157 I A 1.8341
158 D A 0.0000
159 A A 1.4666
160 S A 0.8982
161 Y A 1.0530
162 E A 0.0000
163 Y A 0.5214
164 S A 0.0000
165 K A -2.2851
166 L A 0.0000
167 D A -3.3361
168 D A -3.6247
169 V A -2.6186
170 K A -2.6652
171 V A 0.0000
172 G A 0.0000
173 T A 0.0000
174 A A 0.4240 mutated: WA174A
175 M A 0.0000
176 L A 2.6163
177 G A 0.0000
178 A A 1.9542
179 G A 1.7133
180 Y A 2.3208
181 R A 0.0000
182 F A 2.1977

 

Laboratory of Theory of Biopolymers 2015