Project name: SH3_L124C

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA124C
Energy difference between WT (input) and mutated protein (by FoldX)	1.66205 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2002
• Average score: -0.9392
• Total score value: -56.3499

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4693
82	S	A	-0.7073
83	H	A	-0.8096
84	M	A	0.2331
85	T	A	-0.3643
86	F	A	-0.1465
87	V	A	-0.6438
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2408
99	D	A	-1.3222
100	L	A	0.0000
101	S	A	-1.9031
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.2588
108	L	A	0.0000
109	Q	A	-0.5185
110	I	A	0.3525
111	V	A	1.2002
112	N	A	-0.4418
113	N	A	-1.8138
114	T	A	-1.7326
115	E	A	-2.9361
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3421
119	W	A	-0.7011
120	L	A	0.3772
121	A	A	0.0000
122	H	A	-0.5965
123	S	A	0.0000
124	C	A	-0.7988	mutated: LA124C
125	T	A	-1.0170
126	T	A	-1.0214
127	G	A	-0.9714
128	Q	A	-1.5018
129	T	A	-0.5836
130	G	A	0.0000
131	Y	A	0.2154
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2855
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0222
139	P	A	-0.1684
140	S	A	-0.1779