Project name: SH3_V111L

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	VA111L
Energy difference between WT (input) and mutated protein (by FoldX)	-1.46967 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 0.4789
• Average score: -0.933
• Total score value: -55.9817

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.5490
82	S	A	-0.6698
83	H	A	-0.7818
84	M	A	0.2832
85	T	A	0.0000
86	F	A	-0.0835
87	V	A	-0.6111
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1605
97	E	A	-2.3591
98	T	A	-1.2497
99	D	A	-1.3396
100	L	A	0.0000
101	S	A	-1.9098
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0506
108	L	A	0.0000
109	Q	A	-0.3756
110	I	A	0.0999
111	L	A	0.4789	mutated: VA111L
112	N	A	-0.6779
113	N	A	-1.9396
114	T	A	-1.7844
115	E	A	-2.9051
116	G	A	-2.5932
117	D	A	-2.6907
118	W	A	-1.3296
119	W	A	-0.8232
120	L	A	0.2008
121	A	A	0.0000
122	H	A	-0.5238
123	S	A	0.0000
124	L	A	-0.2502
125	T	A	-0.7746
126	T	A	-0.8700
127	G	A	-0.8032
128	Q	A	-1.3987
129	T	A	-0.5792
130	G	A	0.0000
131	Y	A	0.0996
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2890
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1419
140	S	A	-0.1759