Project name: SH3_H122M

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	HA122M
Energy difference between WT (input) and mutated protein (by FoldX)	-0.49859 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.367
• Average score: -0.8619
• Total score value: -51.7156

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4446
82	S	A	-0.6740
83	H	A	-0.7850
84	M	A	0.2779
85	T	A	0.0000
86	F	A	-0.0902
87	V	A	-0.6150
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2417
99	D	A	-1.3232
100	L	A	0.0000
101	S	A	-1.9037
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-1.9997
108	L	A	0.0000
109	Q	A	-0.0424
110	I	A	0.5732
111	V	A	1.3670
112	N	A	-0.3655
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.6515
120	L	A	0.5060
121	A	A	0.0000
122	M	A	0.0746	mutated: HA122M
123	S	A	0.0000
124	L	A	-0.1576
125	T	A	-0.7206
126	T	A	-0.8093
127	G	A	-0.7022
128	Q	A	-1.2831
129	T	A	-0.3016
130	G	A	0.0000
131	Y	A	0.2818
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2857
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1446
140	S	A	-0.1759