Project name: SH3_N135G

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	NA135G
Energy difference between WT (input) and mutated protein (by FoldX)	0.0924657 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4659
• Maximal score value: 1.2498
• Average score: -0.8519
• Total score value: -51.1154

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.0938
87	V	A	-0.5987
88	A	A	0.0000
89	L	A	-0.1255
90	Y	A	-0.5432
91	D	A	-2.8024
92	Y	A	-2.0799
93	E	A	-2.8840
94	S	A	0.0000
95	R	A	-2.7842
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3270
100	L	A	0.0000
101	S	A	-1.9051
102	F	A	0.0000
103	K	A	-3.4659
104	K	A	-2.8168
105	G	A	-1.9486
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4368
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8147
114	T	A	-1.7328
115	E	A	-2.9367
116	G	A	-2.5236
117	D	A	-2.5479
118	W	A	-1.2317
119	W	A	-0.6219
120	L	A	0.4007
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4950
130	G	A	0.0000
131	Y	A	0.2132
132	I	A	0.0000
133	P	A	-0.2843
134	S	A	-0.8762
135	G	A	-0.3958	mutated: NA135G
136	Y	A	0.2952
137	V	A	0.0000
138	A	A	0.1482
139	P	A	-0.1505
140	S	A	-0.1759