Project name: SH3_L124V

Status: done

submitted: 2019-03-14 15:34:10, status changed: 2019-03-14 18:02:00
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues LA124V
Energy difference between WT (input) and mutated protein (by FoldX) 1.60108 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4838
Maximal score value
1.19
Average score
-0.8862
Total score value
-53.1694

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4691
82 S A -0.7068
83 H A -0.8086
84 M A 0.2357
85 T A 0.0000
86 F A -0.1442
87 V A -0.6429
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1540
97 E A -2.3526
98 T A -1.2408
99 D A -1.3222
100 L A 0.0000
101 S A -1.9031
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -1.9807
108 L A 0.0000
109 Q A -0.3383
110 I A 0.3423
111 V A 1.1900
112 N A -0.4466
113 N A -1.8138
114 T A -1.7326
115 E A -2.9361
116 G A -2.6085
117 D A -2.6844
118 W A -1.3421
119 W A -0.7052
120 L A 0.3683
121 A A 0.0000
122 H A -0.3962
123 S A 0.0000
124 V A 0.1129 mutated: LA124V
125 T A -0.5711
126 T A -0.7479
127 G A -0.6706
128 Q A -1.3442
129 T A -0.4837
130 G A 0.0000
131 Y A 0.2099
132 I A 0.0000
133 P A 0.0000
134 S A -1.2855
135 N A -1.2485
136 Y A -0.2039
137 V A 0.0000
138 A A -0.0212
139 P A -0.1670
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015