Project name: SH3_S134G

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA134G
Energy difference between WT (input) and mutated protein (by FoldX)	0.793442 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4824
• Maximal score value: 1.236
• Average score: -0.8973
• Total score value: -53.841

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4547
82	S	A	-0.6860
83	H	A	-0.7912
84	M	A	0.2642
85	T	A	0.0000
86	F	A	-0.1018
87	V	A	-0.6173
88	A	A	0.0000
89	L	A	-0.3087
90	Y	A	-0.7310
91	D	A	-2.8500
92	Y	A	-2.1041
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3222
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4824
104	K	A	-2.8592
105	G	A	-1.9600
106	E	A	0.0000
107	R	A	-2.0721
108	L	A	0.0000
109	Q	A	-0.2620
110	I	A	0.4072
111	V	A	1.2360
112	N	A	-0.4269
113	N	A	-1.8216
114	T	A	-1.7317
115	E	A	-2.9372
116	G	A	-2.6115
117	D	A	-2.6894
118	W	A	-1.3460
119	W	A	-0.7046
120	L	A	0.3968
121	A	A	0.0000
122	H	A	-0.3911
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4982
130	G	A	0.0000
131	Y	A	0.2154
132	I	A	0.0000
133	P	A	0.0000
134	G	A	-1.3075	mutated: SA134G
135	N	A	-1.2570
136	Y	A	-0.2079
137	V	A	0.0000
138	A	A	-0.0215
139	P	A	-0.1498
140	S	A	-0.1727