Project name: SH3_R107L

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	RA107L
Energy difference between WT (input) and mutated protein (by FoldX)	-0.221634 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.2119
• Maximal score value: 1.2409
• Average score: -0.7487
• Total score value: -44.9227

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4540
82	S	A	-0.6868
83	H	A	-0.7953
84	M	A	0.2575
85	T	A	0.3377
86	F	A	0.5890
87	V	A	0.2551
88	A	A	0.0000
89	L	A	-0.3171
90	Y	A	-0.7387
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1546
97	E	A	-2.3532
98	T	A	-1.2424
99	D	A	-1.3247
100	L	A	0.0000
101	S	A	-1.9040
102	F	A	0.0000
103	K	A	-3.2119
104	K	A	-2.5425
105	G	A	-1.3552
106	E	A	0.0000
107	L	A	0.3790	mutated: RA107L
108	L	A	0.0000
109	Q	A	0.2327
110	I	A	0.6707
111	V	A	1.2409
112	N	A	-0.4153
113	N	A	-1.8088
114	T	A	-1.7292
115	E	A	-2.9341
116	G	A	-2.6073
117	D	A	-2.6850
118	W	A	-1.3420
119	W	A	-0.7001
120	L	A	0.3967
121	A	A	0.0000
122	H	A	-0.0927
123	S	A	0.0000
124	L	A	0.4065
125	T	A	-0.0700
126	T	A	-0.5651
127	G	A	-0.8417
128	Q	A	-1.4324
129	T	A	-0.5221
130	G	A	0.0000
131	Y	A	0.2104
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2862
135	N	A	-1.2485
136	Y	A	-0.2066
137	V	A	0.0000
138	A	A	-0.0289
139	P	A	0.1139
140	S	A	0.2071