Project name: SH3_D99T

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	DA99T
Energy difference between WT (input) and mutated protein (by FoldX)	1.75642 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4579
• Maximal score value: 1.2538
• Average score: -0.9029
• Total score value: -54.1748

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1072
87	V	A	-0.6262
88	A	A	0.0000
89	L	A	-0.3094
90	Y	A	-0.7186
91	D	A	-2.8068
92	Y	A	-1.9757
93	E	A	-2.7946
94	S	A	-2.0598
95	R	A	-2.7223
96	T	A	-2.0584
97	E	A	-2.2609
98	T	A	-1.0804
99	T	A	-0.9805	mutated: DA99T
100	L	A	0.0000
101	S	A	-1.7979
102	F	A	0.0000
103	K	A	-3.4579
104	K	A	-2.8484
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2489
110	I	A	0.4411
111	V	A	1.2538
112	N	A	-0.4148
113	N	A	-1.8098
114	T	A	-1.7320
115	E	A	-2.9349
116	G	A	-2.6073
117	D	A	-2.6793
118	W	A	-1.2936
119	W	A	-0.6483
120	L	A	0.4711
121	A	A	0.0000
122	H	A	-0.3795
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8781
127	G	A	-0.8169
128	Q	A	-1.3788
129	T	A	-0.4317
130	G	A	0.0000
131	Y	A	0.3861
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2888
135	N	A	-1.2607
136	Y	A	-0.2140
137	V	A	0.0000
138	A	A	-0.0267
139	P	A	-0.1505
140	S	A	-0.1759